PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr012264.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 292aa    MW: 31075.5 Da    PI: 7.1266
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr012264.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding35.13e-111254444
                     S-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHH CS
  Myb_DNA-binding  4 WTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrw 44
                     WT e d+ + +a + ++ +   +W++Ia+ ++ g+tl+++k+++
      Pbr012264.1 12 WTREQDKAFENALAIYPEDssdRWEKIAADVQ-GKTLEEIKHHY 54
                     ********************************.**********9 PP

2Myb_DNA-binding43.85.7e-14122166347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT++E+ l++ + +++G+g+W++I+r +  +Rt+ q+ s+ qky
      Pbr012264.1 122 AWTEDEHRLFLLGLEKYGKGDWRSISRNFVVTRTPTQVASHAQKY 166
                      6*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512937.071762IPR017884SANT domain
SMARTSM007178.3E-9860IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.5E-51059IPR009057Homeodomain-like
SuperFamilySSF466891.73E-111065IPR009057Homeodomain-like
PfamPF002492.2E-81254IPR001005SANT/Myb domain
CDDcd001673.40E-91258No hitNo description
PROSITE profilePS5129417.61114171IPR017930Myb domain
SuperFamilySSF466897.59E-17117172IPR009057Homeodomain-like
SMARTSM007174.5E-11119169IPR001005SANT/Myb domain
TIGRFAMsTIGR015571.5E-17119169IPR006447Myb domain, plants
PfamPF002497.2E-12122166IPR001005SANT/Myb domain
CDDcd001671.22E-10122167No hitNo description
Gene3DG3DSA:1.10.10.605.1E-11122165IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MTVEEAGCSS LWTREQDKAF ENALAIYPED SSDRWEKIAA DVQGKTLEEI KHHYDLLLED  60
ISQIEAGVVP LPCYNSSSEG STSHASDEGT NKKGGHSGNY SNESNHGSKA SRADQERRKG  120
IAWTEDEHRL FLLGLEKYGK GDWRSISRNF VVTRTPTQVA SHAQKYFIRL NSMNKDRRRS  180
SIHDITSVNN GEISAAQGPI TGQANGAAVG SSGKSTKQSP AGAPGVGMYG SALSIGQPIG  240
GPLVSAVGTP VNLPAPPHLA YGVSAPVPGV VPGAPMNMVP MTYPMPHSSH R*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A1e-17777676RADIALIS
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00500DAPTransfer from AT5G08520Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009351753.10.0PREDICTED: transcription factor DIVARICATA
SwissprotQ8S9H71e-65DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLD9ZJ760.0D9ZJ76_MALDO; MYBR domain class transcription factor
STRINGGLYMA18G18140.21e-167(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF46943358
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G08520.11e-113MYB family protein